Reports on Food Safety 2005: Food Monitoring by Peter Brandt (auth.), Peter Brandt (eds.)

By Peter Brandt (auth.), Peter Brandt (eds.)

Food tracking is a device to acknowledge and steer clear of capability hazards to shoppers. whereas the states implement nutrition legislations essentially via suspicion and risk-based investigations, foodstuff tracking is a procedure of repeated consultant measurements and reviews of bad elements and contaminants in meals. The meals tracking programme is a joint investigative programme via the German Federal executive and the federal states that's complementary to legit meals keep an eye on as performed through the states. This record presents the result of the research in 2005 of greater than 5000 samples of fifty meals or nutrients teams of household and overseas origin.

Show description

Read Online or Download Reports on Food Safety 2005: Food Monitoring PDF

Best nonfiction_9 books

Fungal Associations

This re-creation of Fungal institutions makes a speciality of mycorrhizas, lichens and fungal-bacterial symbioses. it's been thoroughly revised, up to date and elevated. well known specialists current thorough reports and speak about the newest findings on molecular interactions among fungi and crops or micro organism that result in morphological adjustments and novel houses within the symbionts.

Social Bioarchaeology

Illustrates new methodological instructions in studying human social and organic version deals a big selection of study on prior populations around the world Explains the valuable beneficial properties of bioarchaeological examine by means of key researchers and tested specialists all over the world content material: bankruptcy 1 construction a Social Bioarchaeology (pages 1–11): Sabrina C.

HIV Protocols

In HIV Protocols, Nelson Michael and Jerome Kim have equipped a suite of state of the art ideas crucial for learning the molecular biology, virology, and immunology of the HIV virus. The tools hide a wide variety of study pursuits, together with quantitation of viral genomes, HIV promoter functionality, B-cell epitope mapping, viral coreceptor utilization, and measurements of T-cell functionality.

Interleukin Protocols

Interleukins, a family members of proteins that keep an eye on immunity and irritation in the course of the physique, also are eager about autoimmune affliction (rheumatoid arthritis, a number of sclerosis, and asthma); are implicated in such different stipulations as melanoma, myocardial infarction, and melancholy; and feature price within the analysis and analysis of many ailments.

Extra resources for Reports on Food Safety 2005: Food Monitoring

Sample text

JNJIZ 95th perc. (JNJIZ Maximum (JNJIZ Legal max. 0 Table P10-1 Residues in various kinds of vegetables. 10 Project 10: Herbicide residues in certain vegetables 2IƤFHLQFKDUJH  &98$6WXWWJDUW 3DUWLFLSDWLQJRIƤFHV /8$%UHPHQ&8$+DJHQ/$9(6/, 2OGHQEXUJ $OWKRXJK KHUELFLGHV PDNH XS WKH ODUJHVW VKDUH LQ WKH WR WDO DPRXQW RI SODQW SURWHFWLRQ SURGXFWV XVHG WKHUH LV VWLOO RQO\ OLWWOH LQIRUPDWLRQ DERXW WKH SUHVHQFH DQG OHYHOV RI WKLV FODVV RI SHVWLFLGHV LQ IRRGVWXIIV +HUELFLGHV DUH PRVW ZLGH O\ XVHG LQ FHUHDOV RLOVHHG UDSH DQG VXJDU EHHW FURSV EXW WKH\ DUH DOVR DSSOLHG LQ YHJHWDEOH FURSV LQ SDUWLFXODU VXFK ZKLFK DUH PDFKLQHKDUYHVWHG 7KH SUHVHQW SURMHFW UXQV RYHU VHYHUDO \HDUV DQG ZLOO ORRN LQWR KHUELFLGH UHVLGXHV LQ YDULRXVYHJHWDEOHFURSVZLWKWKHDLPWRFRPSLOHUHOHYDQWUHVL GXHGDWD ,QWKLVUHSRUWLQJ\HDUDWRWDORIVDPSOHVRIYDULRXVNLQGV RIYHJHWDEOHVZHUHH[DPLQHGIRUUHVLGXHVRIDJUHHGREOLJD WRU\ KHUELFLGH VXEVWDQFHV DQG DQRWKHU PD[LPXP  DFWLYH VXEVWDQFHV RI SHVWLFLGHV 5HVLGXHV RI  YDULRXV DFWLYH VXE VWDQFHVZHUHIRXQGLQRIWKHVDPSOHV  RIWKHVXE VWDQFHVEHLQJKHUELFLGHVIURPWKHDJUHHGREOLJDWRU\VSHFWUXP RIH[DPLQDWLRQ 5HVLGXHVDERYHOHJDOPD[LPXPUHVLGXHOHYHOVZHUHIRXQG LQ  YHJHWDEOH VDPSOHV  OHDI YHJHWDEOHV  URRW YHJHWDEOHV  7KUHHRIWKHFDVHVZHUHDWWULEXWDEOHWRH[FHVVLYHKHUELFLGHUHVL GXHV [OLQXURQ[KDOR[\IRS LQOHDIYHJHWDEOHV [GLOO[VSL QDFK 5HVLGXHƤQGLQJVLQWKHYDULRXVNLQGVRIYHJHWDEOHVDUH OLVWHGLQ7DEOH3 7KHƤQGLQJVRIWKHSURMHFWDUHWKDWDFWLYHVXEVWDQFHVRIKHU ELFLGHVDUHTXLWHRIWHQIRXQGDVUHVLGXHVLQOHDIDQGURRWYHJHWD EOHV(YHU\WKLUGSODQWSURWHFWLRQSURGXFWUHVLGXHIRXQGVWHP PHGIURPDKHUELFLGH RXWRISRVLWLYHUHVLGXHƤQGLQJV 

DUOVUXKH 3DUWLFLSDWLQJRIƤFHV /$9(6 1LHGHUVDFKVHQ /8$ 6SH\HU 68$ :LHVEDGHQ &98$ )UHLEXUJ //%%UDQGHQEXUJ )XUDQ VHHJORVVDU\ ZDVƤUVWGHWHFWHGLQFRIIHHLQ)XUDQ PD\EHIRUPHGLQIRRGVWXIIVLQWKHFRXUVHRIZKDWLVFDOOHGWKH 0DLOODUGUHDFWLRQZKHQFDUERK\GUDWHVDUHKHDWHG)XUDQLVDOVR IRUPHGZKHQDVFRUELFDFLGDPLQRDFLGVRUSRO\XQVDWXUDWHGIDW W\DFLGVDUHKHDWHG)XUDQOHYHOVZLOOEHSDUWLFXODUO\KLJKZKHQ IRRG LV URDVWHG IRU LQVWDQFH FRIIHH EHDQV  RU KHDWHG LQ FORVHG V\VWHPV IRULQVWDQFHEDE\IRRGDQGUHDG\WRHDWPHDOV  ,QWKHIUDPHZRUNRIWKLVSURMHFWDWRWDORIIRRGVDPSOHV ZHUH DQDO\VHG IRU IXUDQ 6DPSOH QXPEHUV DQG VRPH VWDWLVWL FDOLQGLFHVRIPHDVXUHPHQWVLQWKHIRRGJURXSVDUHVKRZQLQ 7DEOH3EHORZ 7KHPHDVXUHPHQWVVKRZWKDWIXUDQLVSUHVHQWLQQHDUO\DOO IRRGJURXSVDQDO\VHG VHH7DEOHDQG)LJXUH3 :KLOHOHYHOV LQERXLOORQDQGVWRFNSURGXFWVZKHUHEHORZWKHOLPLWRITXDQ WLƤFDWLRQ VRXSV KDG DYHUDJH OHYHOV RI  DQG íJNJ $YHUDJH OHYHOV LQ OLTXLG UHDG\WRHDW VRXSV ZHUH WKUHH WLPHV KLJKHUDQGPHGLDQVƤYHWLPHVKLJKHUWKDQLQGULHGVRXSSUR GXFWV 'ULHGIRRGSURGXFWVVXFKDVGULHGVRXSVDUHƤQDOO\SUHSDUHG LQKRXVHKROGV7KHUHIRUHWKHDPRXQWRIIXUDQZKLFKLVƤQDOO\ LQJHVWHGE\DFRQVXPHUGHSHQGVRQKRZWKHIRRGLVSUHSDUHG DW KRPH 5HOHYDQW IRU FRQVXPHU SURWHFWLRQ DUH WKHUHIRUH RQ WKH RQH KDQG VXFK SURGXFWV ZKLFK FDUU\ UHODWLYHO\ KLJK OHYHOV RI IXUDQ VXFK DV FRIIHH DQG RQ WKH RWKHU IRRGVWXIIV ZKLFK DUH GLUHFWO\ FRQVXPHG 7KH ODWWHU LQFOXGH UHDG\WRHDW PHDOV ZLWK DQDYHUDJHIXUDQFRQWHQWRIíJNJDQGUHDG\WRHDWEDE\ DQGLQIDQWIRRGZLWKDYHUDJHIXUDQFRQWHQWVRIDQGíJ NJ)XUDQFRQWDPLQDWLRQRILQIDQWIRRGLVSDUWLFXODUO\UHOHYDQW EHFDXVHRIWKHORZERG\ZHLJKWRIWKHqWDUJHWFRQVXPHUVr0D[ LPXP IXUDQ OHYHOV PHDVXUHG LQ EDE\ DQG LQIDQW IRRG ZHUH íJNJDQGíJNJUHVSHFWLYHO\ Table P01-1 Findings of furan in foodstuffs.

DUOVUXKH &98$ 0ÙQVWHU /*/ 2EHUVFKOHL¼ KHLP &/8$ 3DGHUERUQ /9*$ 6DDUEUÙFNHQ&98$6WXWWJDUW&8$ 9LHUVHQ Table P03-1 Total alkaloid content as a function of origin. /HDG DQG FDGPLXP DUH XELTXLWRXV LQ WKH HQYLURQPHQW DQG HQWHU IRRGVWXIIV DQG GLHWDU\ VXSSOHPHQWV YLD GLIIHUHQW SDWKV 1HLWKHU *HUPDQ\ QRU WKH (8 KDV UHJXODWHG PD[LPXP OHYHOV RI OHDG DQG FDGPLXP LQ GLHWDU\ VXSSOHPHQWV %XW WKHUH KDYH EHHQ VRPH WKRXJK UDUH QRWLƤFDWLRQV ZLWKLQ WKH (XURSHDQ 5DSLG$OHUWV6\VWHPIRU)RRGDQG)HHG 5$6)) DERXWLQFUHDVHG OHYHOVRIOHDGDQGFDGPLXPLQVRPHGLHWDU\VXSSOHPHQWVVLQFH (8H[SHUWVDUHWKHUHIRUHGLVFXVVLQJWKHQHHGIRUDQ(8 ZLGHOHJDOPD[LPXPOHYHOIRUOHDGDQGRUFDGPLXPLQGLHWDU\ VXSSOHPHQWV $QDO\VHV LQ WKH IUDPHZRUN RI WKLV SURMHFW PHDVXUHG OHDG DQG FDGPLXP OHYHOV LQ YLWDPLQ SUHSDUDWLRQV PLQHUDO VXE VWDQFH SUHSDUDWLRQV FRPELQHG YLWDPLQ DQG PLQHUDO SUHSD UDWLRQV SODQW H[WUDFW SUHSDUDWLRQV DQG DOJDO SUHSDUDWLRQV $ WRWDO RI  VDPSOHV ZHUH H[DPLQHG ERWK IURP *HUPDQ DQG IRUHLJQ PDQXIDFWXUHUV ZKLOH QR VLJQLƤFDQW GLIIHUHQFHV EH WZHHQGRPHVWLFDQGIRUHLJQSURGXFWVZHUHIRXQG7KHDQDO\WLF OLPLWRITXDQWLƤFDWLRQZKLFKKDGWREHPHWDVDPLQLPXPZDV PJNJIRUOHDGDQGPJNJIRUFDGPLXPHDFKUHODWHGWR WKHNLQGRIPDWWHUDVZKLFKWKHSURGXFWLVRIIHUHG ,WZDVIRXQGWKDWVDPSOHV  FRQWDLQHGTXDQWLƤDEOH OHYHOVRIOHDGDQG  TXDQWLƤDEOHOHYHOVRIFDGPLXP $ FRPSDULVRQ RI WKH GLIIHUHQW SURGXFW JURXSV VKRZV WKDW YLWDPLQSUHSDUDWLRQVZHUHWKHRQHVZLWKWKHORZHVWOHDGFRQ WHQWV+HUHWKHKLJKHVWFRQFHQWUDWLRQIRXQGZDVPJNJ DQG WKH WK SHUFHQWLOH FRQFHQWUDWLRQ PJNJ 0LQHUDO VXEVWDQFHSUHSDUDWLRQVFRPELQHGYLWDPLQDQGPLQHUDOSUHS DUDWLRQV DQG SODQW H[WUDFW SUHSDUDWLRQV FDUULHG PD[LPXP FRQFHQWUDWLRQV EHWZHHQ  DQG PJNJ 6R WKHVH SURGXFW JURXSV LQFOXGH VLQJOH FDVHV RI FOHDUO\ KLJKHU FRQWDPLQDWLRQ ZLWKOHDG 7KHVLWXDWLRQZLWKFDGPLXPLQWKHGLHWDU\VXSSOHPHQWVH[ DPLQHGXQGHUWKLVSURMHFWLVVLPLODU9LWDPLQSUHSDUDWLRQVPLQ HUDO VXEVWDQFH SUHSDUDWLRQV FRPELQHG YLWDPLQ DQG PLQHUDO SUHSDUDWLRQVDQGSODQWH[WUDFWSUHSDUDWLRQVGLVSOD\HGFDGPL XPOHYHOVRIXSWRPJNJZLWKYLWDPLQSUHSDUDWLRQVDJDLQ EHLQJWKHOHDVWFRQWDPLQDWHG7KLVPD\EHDWWULEXWDEOHWROHVV FRQWDPLQDWLRQ RI WKH YLWDPLQ FRPSRXQGV XVHG FRPSDUHG WR WKH SODQW H[WUDFW DOJDH RU PLQHUDOV XVHG DV UDZ PDWHULDOV IRU WKHRWKHUSURGXFWV &RPSDUHGWRWKHRWKHUSURGXFWJURXSVDOJDOSURGXFWVZHUH FOHDUO\ PRUH FRQWDPLQDWHG ZLWK OHDG DQG FDGPLXP ,Q FRQ WUDVWWRWKHRWKHUSURGXFWVDOJDOSUHSDUDWLRQVFDUULHGTXDQWLƤ DEOHOHDGLQRIWKHVDPSOHVDQGGHWHFWDEOHFDGPLXPLQ RIVDPSOHV /HDG LQ  VDPSOHV H[FHHGHG PJNJ WKH KLJKHVW FRQFHQ WUDWLRQEHLQJPJNJ(LJKWVDPSOHVFDUULHGFDGPLXPOHYHOV RI PRUH WKDQ PJNJ ZLWK D PD[LPXP RI PJNJ 6XFK FRQWDPLQDWLRQPXVWEHHYDOXDWHGDVH[WUHPHO\KLJK$OOWKHVH 37 38 BVL Report on Food and Feed Safety 2005 Number of Samples with samples TXDQWLĥDEOH levels Average con- Median centration 90th perc.

Download PDF sample

Rated 4.25 of 5 – based on 19 votes